element.find('ul').slideUp(); { { { ] "context" : "envParam:quiltName", ] "actions" : [ //$(window).scroll(function() { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'YBCw5kXrLyvVZbVfznr8-YCiEOhdBQUyqtSd8Z8aiyY. "context" : "", "actions" : [ } { "action" : "rerender" })(LITHIUM.jQuery); // Pull in global jQuery reference "event" : "ProductAnswer", } } "componentId" : "forums.widget.message-view", "}); "componentId" : "forums.widget.message-view", "linkDisabled" : "false" { ] } } "event" : "MessagesWidgetEditAnswerForm", { } "floatedBlock" : "acceptedSolutions", count = 0; } "messageViewOptions" : "1111110111111111111110111110100101101101" { "eventActions" : [ ] Fertig. "action" : "rerender" { createStorage("false"); { "context" : "", { "initiatorBinding" : true, } "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'ofkxD_AdTfOkn7iyoftG85NVCF0IK1zlA08WrYDR_xE. ] { "context" : "", } Vielen Dank! }, }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "ProductAnswer", window.onload = function() { "context" : "", { "quiltName" : "ForumMessage", "actions" : [ Jetzt erscheinen die Vodafone OneNumber (Red+ MultiSIM) Nutzungsbedingungen. "context" : "envParam:quiltName,message", ] "disableKudosForAnonUser" : "false", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "AcceptSolutionAction", "actions" : [ "event" : "removeMessageUserEmailSubscription", ] { // Set start to true only if the first key in the sequence is pressed ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" } } } ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2228045 .lia-rating-control-passive', '#form_2'); "context" : "", 2019 gab es mit den Netzbetreibern Vodafone, o2 und der Telekom nur drei eSIM … "action" : "rerender" ] "action" : "rerender" var watching = false; "action" : "rerender" } "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "", { "context" : "envParam:quiltName,expandedQuiltName", "truncateBodyRetainsHtml" : "false", { "context" : "", }); "action" : "rerender" "context" : "", { ] "disableLabelLinks" : "false", $(document).ready(function(){ } ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { "event" : "expandMessage", })(LITHIUM.jQuery); "event" : "removeMessageUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/239367","ajaxErrorEventName":"LITHIUM:ajaxError","token":"18yE-Y63c0xh_xRZEUr4UcerbO2VlcWWAjT-vAY_2LQ. "actions" : [ eSIM Profil herunterladen, freischalten. })(LITHIUM.jQuery); // just for convenience, you need a login anyways... ], "action" : "rerender" "action" : "addClassName" } "action" : "pulsate" "context" : "", { "action" : "rerender" } { $('#custom-overall-notif-count').html(notifCount); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } //}); }, "actions" : [ "action" : "pulsate" "context" : "envParam:selectedMessage", Die eSIM erhalten Sie immer kostenlos zu Ihrem Tarif dazu und … ] { }); "actions" : [ "actions" : [ ] { "eventActions" : [ "disableLabelLinks" : "false", "disableLinks" : "false", "disableKudosForAnonUser" : "false", "actions" : [ { "showCountOnly" : "false", } // just for convenience, you need a login anyways... ] LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Was genau hat Dir gefehlt? "event" : "ProductAnswer", "parameters" : { "action" : "rerender" } "action" : "rerender" Dabei bietet Vodafone die eSIM für alle Vertragstarife an und erlaubt die Nutzung als Haupt- und Zweitkarte. "context" : "envParam:quiltName,expandedQuiltName", ] { "action" : "pulsate" "event" : "RevokeSolutionAction", }, }, { if (event.target.matches('.redirect')) { "eventActions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } // console.log(key); "disallowZeroCount" : "false", "actions" : [ watching = false; "parameters" : { var handleClose = function(event) { { }, "event" : "MessagesWidgetAnswerForm", ] "action" : "rerender" "showCountOnly" : "false", } "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { }, "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/239367","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Xulihd0J8e1TjMdmcHvH8HomrVwlgQKV6MlftwzR3Ck. "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "context" : "envParam:quiltName", "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2225865,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. if (element.hasClass('active')) { }, Verwalte Deine Verträge, Kundendaten und Geräteeinstellungen für MeinVodafone. "messageViewOptions" : "1111110111111111111110111110100101101101" })(LITHIUM.jQuery); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2228045 .lia-rating-control-passive', '#form_2'); Man bekommt mit der Callya Freikarte also die originalen Vodafone Prepaid Tarife und Angebote. { // Oops, not the right sequence, lets restart from the top. $(this).next().toggle(); ] "truncateBody" : "true", "defaultAriaLabel" : "", Mehr dazu: Wie lade ich mein eSIM-Profil runter und aktiviere die eSIM? { "truncateBodyRetainsHtml" : "false", { "action" : "addClassName" { }, congstar-Kunden erhalten kostenlose eSIM im Kartentausch von: M_Schwarten congstar bietet seinen Bestandskunden ab sofort die Möglichkeit, die vorhandene SIM-Karte kostenlos in eine eSIM … "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "context" : "", }, } "actions" : [ Auch bei O2 sind die eSIM kostenlos, allerdings nur noch bis Ende 2019. "actions" : [ "action" : "rerender" } "context" : "", } }, } "action" : "rerender" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { "dialogContentCssClass" : "lia-panel-dialog-content", "forceSearchRequestParameterForBlurbBuilder" : "false", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" Vodafone-Kunden mit Postpaid-Tarifen können ab sofort eSIMs beantragen. }, } "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetAnswerForm", { }, "actions" : [ element.siblings('li').children('ul').slideUp(); { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); ] "actions" : [ Also aufpassen bei den Kosten und Mitarbeiter aussagen. Kostenlose amazon kreditkarte mit 40 startguthaben. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "kudosLinksDisabled" : "false", "context" : "envParam:feedbackData", } // Reset the conditions so that someone can do it all again. }, { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "entity" : "2225865", "action" : "rerender" "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, ', 'ajax'); { ;(function($) { { "displaySubject" : "true", { ] ] ] "actions" : [ "action" : "rerender" LITHIUM.Dialog({ "event" : "markAsSpamWithoutRedirect", "componentId" : "kudos.widget.button", }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" } "event" : "approveMessage", "eventActions" : [ }, LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "actions" : [ }); müssen. }, { "disableLinks" : "false", LITHIUM.AjaxSupport.useTickets = false; ], "truncateBodyRetainsHtml" : "false", }, "event" : "MessagesWidgetCommentForm", Bist du sicher, dass du fortfahren möchtest? "includeRepliesModerationState" : "false", "entity" : "2225865", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'dMQ-KRTs7SkFeLZjXN6lj0wwfV2MKqziKHIGeVtE56c. ] }, ] { } "action" : "rerender" Vertrag dazu buchen. "includeRepliesModerationState" : "false", Kostenlose eSIM für Vodafone Neukunden und Bestandskunden. "event" : "MessagesWidgetEditAction", { "truncateBody" : "true", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "actions" : [ var expireDate = new Date(); LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); }, LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_2061f642b8b504', 'enableAutoComplete', '#ajaxfeedback_2061f642b8b504_0', 'LITHIUM:ajaxError', {}, '7SbHQ6AFKQNjMYJiPGl0ObL2FCDnDnzyld8Fsf-YZlQ. "context" : "envParam:quiltName,message", { element.find('ul').slideUp(); "event" : "MessagesWidgetEditAnswerForm", "actions" : [ } { "action" : "rerender" Prüf bitte zuerst, ob Du diese Voraussetzung erfüllst: Gut zu wissen: Du findest Deine 6-stellige ePIN auch in MeinVodafone. "event" : "removeThreadUserEmailSubscription", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { ], LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "forceSearchRequestParameterForBlurbBuilder" : "false", } "event" : "MessagesWidgetEditAnswerForm", Wähl Bitte gib Deine Handy-Nummer ein. { "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:feedbackData", "action" : "rerender" "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { "disableLinks" : "false", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2225805,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, "context" : "", "activecastFullscreen" : false, } Der Download zeigt Ihnen, wie Sie als Vodafone-Kunde Ihre eSIM nutzen können. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", } "event" : "removeMessageUserEmailSubscription", } { "context" : "envParam:entity", }, { } { "action" : "pulsate" .attr('aria-selected','false'); { } }, Lösch Dein Profil vollständig von Deinem alten Gerät. "selector" : "#messageview_0", // console.log(key); "kudosLinksDisabled" : "false", }, } Wir können Dir auf Dein Feedback nicht antworten! "action" : "rerender" Somit bietet o2 hier die gleiche Flexibilität wie Vodafone. } "action" : "rerender" "actions" : [ "initiatorBinding" : true, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, "action" : "rerender" })(LITHIUM.jQuery); // Pull in global jQuery reference //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); { "componentId" : "kudos.widget.button", { "actions" : [ "context" : "", { }, }, "actions" : [ "initiatorBinding" : true, "event" : "ProductMessageEdit", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "entity" : "2228045", ] "actions" : [ { "actions" : [ "initiatorBinding" : true, "disableLinks" : "false", "initiatorBinding" : true, $('#node-menu li.active').children('ul').show(); } "messageViewOptions" : "1111110111111111111110111110100101001101" "showCountOnly" : "false", "context" : "", } element.addClass('active'); "}); }, "actions" : [ "quiltName" : "ForumMessage", In der Regel nach wenigen Minuten.In Ausnahmefällen kann es bis zu 36 Stunden dauern. "parameters" : { "useTruncatedSubject" : "true", "action" : "rerender" }, } // We made it! "context" : "envParam:entity", } } } "action" : "pulsate" "useTruncatedSubject" : "true", ;(function($) { "actions" : [ { }); { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, "actions" : [ }, "actions" : [ "event" : "MessagesWidgetAnswerForm", "actions" : [ { "event" : "markAsSpamWithoutRedirect", // Oops. } ] "context" : "envParam:quiltName", }, "action" : "addClassName" watching = false; Execute whatever should happen when entering the right sequence "event" : "ProductMessageEdit", "context" : "", }, ] { "action" : "rerender" "useCountToKudo" : "false", "truncateBodyRetainsHtml" : "false", // Reset the conditions so that someone can do it all again. { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/2001/thread-id/239367","ajaxErrorEventName":"LITHIUM:ajaxError","token":"34IQMN2kw7gji2qoGQKeitjl2oVYdZWyy0C_6B3PGYo. "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,product,contextId,contextUrl", }, }, "action" : "pulsate" "useSimpleView" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "event" : "deleteMessage", { "actions" : [ "useTruncatedSubject" : "true", sessionStorage.setItem("is_scroll", option); "event" : "ProductAnswer", }, "defaultAriaLabel" : "", "context" : "", ;(function($) { ] "action" : "pulsate" "}); { } else { { "action" : "rerender" "context" : "", }, "parameters" : { } "event" : "removeMessageUserEmailSubscription", }, } "event" : "removeThreadUserEmailSubscription", }, "event" : "ProductAnswer", { Hilfe zum Login. } } Wie bestelle ich direkt beim Einrichten meines Windows 10-Geräts eine eSIM? "action" : "rerender" { "linkDisabled" : "false" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "showCountOnly" : "false", Gut zu wissen: Das eSIM-Profil für Deine Watch bekommst Du nur als Vodafone OneNumber zusätzlich zu Deiner Hauptkarte. So einfach geht's: Meld Dich mit Deinen Kundendaten an und such Dir Deine Vodafone OneNumber als eSIM aus. } { }, ] "action" : "pulsate" "useSubjectIcons" : "true", { LITHIUM.Dialog.options['670353797'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "ProductAnswer", LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_2061f642b8b504","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "actions" : [ { "event" : "removeThreadUserEmailSubscription", "showCountOnly" : "false", { ] }, "event" : "addMessageUserEmailSubscription", "context" : "", { { "context" : "lia-deleted-state", Starte dann den Download noch einmal. Verlangen Sie dort gezielt die Vodafone TwinCard zu Ihrem Vertrag, diese können Sie jederzeit zu Ihrem Tarif bzw. { ], $(this).toggleClass('active'); "eventActions" : [ ;(function($) { { }, }, "showCountOnly" : "false", "event" : "ProductMessageEdit", } "actions" : [ How to use dual sim in iphone 11 and iphone 11 pro setup esim. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "context" : "lia-deleted-state", } "event" : "ProductAnswerComment", { "action" : "rerender" { "actions" : [ { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'ofkxD_AdTfOkn7iyoftG85NVCF0IK1zlA08WrYDR_xE. { "action" : "rerender" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.ComponentEvents.set({ if ( neededkeys[count] == key ) { ] LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); }, "action" : "rerender" } "action" : "rerender" } ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "event" : "deleteMessage", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_2061f642b8b504_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/2001/thread-id/239367&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "MessagesWidgetMessageEdit", { Ist für 4,95 € sogar eine Allnet-Flat. "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", '; "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "MessagesWidgetEditAnswerForm", "actions" : [ }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2225865 .lia-rating-control-passive', '#form_1'); { } } } "useCountToKudo" : "false", "context" : "", "componentId" : "forums.widget.message-view", ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); Du bekommst von uns einen Aktivierungscode und eine ePIN (Bestätigungscode). "event" : "ProductAnswerComment", } LITHIUM.AjaxSupport.ComponentEvents.set({ return; zugreifen, ohne Dich jedes Mal einloggen zu "linkDisabled" : "false" ] }); ] "actions" : [ }, LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. logmein: [76, 79, 71, 77, 69, 73, 78], var cookieDomain = 'forum.vodafone.de'; }); "event" : "MessagesWidgetAnswerForm", }, "entity" : "2225865", Du bist Dir unsicher, wo Du Dich einloggen sollst? "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", }, } } }); "action" : "rerender" } "actions" : [ "dialogKey" : "dialogKey" { "event" : "MessagesWidgetEditAction", { //if(height > 430) { count++; Dann klick auf die Buttons, Lieferanten-Buchhaltung / Accounts Payable, Angebote und Informationen für CallYa Kunden, AutoLogin window.location.replace('/t5/user/userloginpage'); //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} Oder wende Dich an den Hersteller. ] LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); } "event" : "unapproveMessage", "event" : "MessagesWidgetEditAnswerForm", } "action" : "rerender" // Oops. "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2225805}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2225865}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2225865}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2228045}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2537528}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2538432}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2538414}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2449428}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542462}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549229}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549131}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549122}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549103}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549098}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548949}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548915}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548898}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548778}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548727}}]); ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] { Tausch sie in eine eSIM in MeinVodafone > Neue SIM-Karte. { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"});